PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10013329m
Common NameEUTSA_v10013329mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MYB
Protein Properties Length: 502aa    MW: 55710.4 Da    PI: 5.3419
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10013329mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.1e-173481148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+  Ed++lvd+vk++G g+W+++ ++ g+ R++k+c++rw ++l
  Thhalv10013329m 34 KGPWSSAEDDILVDYVKKHGEGNWNAVQKHTGLFRCGKSCRLRWANHL 81
                     79******************************************9986 PP

2Myb_DNA-binding53.74.9e-1787130146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l+v++++++G++ W++ a++++ gRt++++k++w++
  Thhalv10013329m  87 KGAFSQEEEQLIVELHAKMGNR-WARMAAHLP-GRTDNEIKNYWNT 130
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0016931.9E-2461501IPR016310Transcription factor, GAMYB
PROSITE profilePS5129415.9652981IPR017930Myb domain
SuperFamilySSF466897.86E-3032128IPR009057Homeodomain-like
SMARTSM007176.7E-153383IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-233588IPR009057Homeodomain-like
CDDcd001671.09E-113681No hitNo description
PfamPF139215.6E-163797No hitNo description
PROSITE profilePS5129426.2582136IPR017930Myb domain
SMARTSM007172.7E-1786134IPR001005SANT/Myb domain
CDDcd001671.24E-1289130No hitNo description
Gene3DG3DSA:1.10.10.604.7E-2689136IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 502 aa     Download sequence    Send to blast
MSYTSTEMGS DNESPFTDNG SDCRSRWEGN ALKKGPWSSA EDDILVDYVK KHGEGNWNAV  60
QKHTGLFRCG KSCRLRWANH LRPNLKKGAF SQEEEQLIVE LHAKMGNRWA RMAAHLPGRT  120
DNEIKNYWNT RIKRRLRAGL PLYPPEMHVE VLEWSPEYTE SRILGGDRRH QDFLQLGSCE  180
SNVFFDSLNF VSDMLPGTSN LADMVSCKTL GNGASSPRYE DFMPLLIPSS KRFRGSESLY  240
PGCSSTIKEE IPSPEHFQNT APQKISKTCS FLVPCDVDHL PYGNQHSPVM IPDSHTLTDG  300
LVPTSNPSLG AVKLELPSFQ YSEATFDQWK KSASPPQSDI LDPFDAYIQS PPPLGREDSD  360
CFPNCDTGLL DMLLLEAKIR NNSTNNSLYK SCASTSPSNV VGVSVSQIKS EEFDDSLKSL  420
VHSEISISTQ HNADGIPPRQ REKERQPVLD ITRPDVWLAS SWLDHGLGIG KEAGSMSDAI  480
AVFLGDDIGN DYMQMSVGAS L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-322313613128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130136RIKRRLR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399071.10.0hypothetical protein EUTSA_v10013329mg
TrEMBLV4LA660.0V4LA66_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.6__546__AT5G06100.30.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.30.0myb domain protein 33